RetrogeneDB ID: | retro_mmus_3258 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 9:31274882..31275272(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000091003 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Nop16 | ||
| Ensembl ID: | ENSMUSG00000025869 | ||
| Aliases: | Nop16, AA409471, D13Wsu177e | ||
| Description: | NOP16 nucleolar protein [Source:MGI Symbol;Acc:MGI:107862] |
| Percent Identity: | 80.77 % |
| Parental protein coverage: | 71.91 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | QNLAEMGLAMDPNKAVPLRKKKVKAMEVDTEERPRDLVRKPYVVNDLEAEASLPEKKGNTLSRD-LIDYV |
| .NLAEMGLA.DPN.AVPLRK.KVKAMEVDTEERP.DLVRKP.VV.DLEAEASLPEKKG.TLS.D.LIDYV | |
| Retrocopy | RNLAEMGLAVDPNRAVPLRKRKVKAMEVDTEERPKDLVRKPCVVKDLEAEASLPEKKGSTLSLDLLIDYV |
| Parental | RYMVENHGEDYKAMARDEKNYYQDTPKQIRNKINVYKRFYPTEWQAFI-DSLQSKKMEVD |
| .YMVENH.ED.KAMARD.KNYYQ.TPK.I.NK..VYK.FYP.E.QAFI.DSLQ.KKM.VD | |
| Retrocopy | HYMVENHEEDDKAMARDKKNYYQETPKRIPNKVDVYKPFYPMECQAFIDDSLQNKKMGVD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .07 RPM | 12 .52 RPM |
| SRP007412_cerebellum | 0 .09 RPM | 10 .42 RPM |
| SRP007412_heart | 0 .03 RPM | 9 .99 RPM |
| SRP007412_kidney | 0 .10 RPM | 19 .10 RPM |
| SRP007412_liver | 0 .05 RPM | 18 .30 RPM |
| SRP007412_testis | 0 .14 RPM | 10 .20 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000012315 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000026072 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010391 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003504 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000012552 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000025869 | 2 retrocopies |
retro_mmus_3033, retro_mmus_3258 ,
|
| Rattus norvegicus | ENSRNOG00000017284 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029577 | 1 retrocopy |