RetrogeneDB ID: | retro_mmus_3107 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 8:15437864..15438149(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Gabarap | ||
| Ensembl ID: | ENSMUSG00000018567 | ||
| Aliases: | None | ||
| Description: | gamma-aminobutyric acid receptor associated protein [Source:MGI Symbol;Acc:MGI:1861742] |
| Percent Identity: | 81.05 % |
| Parental protein coverage: | 81.2 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
| MKF..KEEHPFEK..SEGEKI.KK.PD.VPVIVEK.PKA.IG.LDKK.YLVPSDL.VGQFYFLIRK.IHL | |
| Retrocopy | MKFQCKEEHPFEKCCSEGEKIQKKSPDWVPVIVEKVPKAQIGVLDKKEYLVPSDLMVGQFYFLIRKGIHL |
| Parental | RAEDALFFFVNNVIPPTSATMGQLY |
| .AED.LF.F.NNVIP.TSATMGQLY | |
| Retrocopy | PAEDSLFLFGNNVIPSTSATMGQLY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 82 .75 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 74 .81 RPM |
| SRP007412_heart | 0 .00 RPM | 127 .76 RPM |
| SRP007412_kidney | 0 .00 RPM | 172 .73 RPM |
| SRP007412_liver | 0 .00 RPM | 129 .61 RPM |
| SRP007412_testis | 0 .05 RPM | 178 .15 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ciona intestinalis | ENSCING00000012473 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016655 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013770 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000018567 | 1 retrocopy |
retro_mmus_3107 ,
|
| Mus musculus | ENSMUSG00000031812 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000031950 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008049 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006997 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007901 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000034115 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017417 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000017936 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0052672 | 1 retrocopy |