RetrogeneDB ID: | retro_ggor_821 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 12:90123064..90123290(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | GABARAP | ||
| Ensembl ID: | ENSGGOG00000013770 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.69 % |
| Parental protein coverage: | 61.79 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKA-PKAR-IGDLDKKKYLVPSDLTVGQFYFLIRKRIH |
| KFVYKEEHP.E..RSEGEKI..KY.....V......PK.R..GDLDKKKY...S.LTVGQF..LI.K..H | |
| Retrocopy | KFVYKEEHPLEEYRSEGEKIQRKYSELAGVSGKAS<PKLR<MGDLDKKKYMMLSHLTVGQFHLLIWK*TH |
| Parental | LRAEDALF |
| L..E..L. | |
| Retrocopy | LKLELILY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 124 .78 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 87 .82 RPM |
| SRP007412_heart | 0 .00 RPM | 82 .55 RPM |
| SRP007412_kidney | 0 .00 RPM | 189 .89 RPM |
| SRP007412_liver | 0 .00 RPM | 136 .03 RPM |
| SRP007412_testis | 0 .00 RPM | 130 .43 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ciona intestinalis | ENSCING00000012473 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016655 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012299 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013770 | 1 retrocopy |
retro_ggor_821 ,
|
| Gorilla gorilla | ENSGGOG00000022360 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000018567 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008049 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006997 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007901 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000034115 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017417 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000017936 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0052672 | 1 retrocopy |