RetrogeneDB ID: | retro_mmus_2653 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 5:55722772..55723201(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Tiprl | ||
| Ensembl ID: | ENSMUSG00000040843 | ||
| Aliases: | Tiprl, 1810011K17Rik | ||
| Description: | TIP41, TOR signalling pathway regulator-like (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1915087] |
| Percent Identity: | 81.63 % |
| Parental protein coverage: | 53.14 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected | 3 |
| Parental | CVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESL-KLKVVPTTDHIDTEKLKA |
| CVNNY.GMLK.ACAE..QESRTEGEHS.EVIK..DWTYTT..K.TLLGESL.KLKVVPTTD.IDTEK.KA | |
| Retrocopy | CVNNY*GMLKAACAE**QESRTEGEHSEEVIKLDDWTYTTE*KETLLGESL<KLKVVPTTDSIDTEKSKA |
| Parental | REQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSS-FFLLLR-FFLRIDGVLIRMNDTRLYHEADKTYML |
| .EQIK.F.EVLLFEDELHDHGVSSL.VKI.V.PSS.FFLLL..F.LRIDGVLIRMND.RL.HEA.KTYML | |
| Retrocopy | KEQIKIFKEVLLFEDELHDHGVSSLGVKIKVTPSS<FFLLLH<FVLRIDGVLIRMNDRRLCHEAGKTYML |
| Parental | REYTSRE |
| .EYTSRE | |
| Retrocopy | *EYTSRE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 38 .60 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 24 .79 RPM |
| SRP007412_heart | 0 .00 RPM | 19 .71 RPM |
| SRP007412_kidney | 0 .00 RPM | 23 .25 RPM |
| SRP007412_liver | 0 .00 RPM | 13 .68 RPM |
| SRP007412_testis | 0 .00 RPM | 44 .05 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000008689 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000009945 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000005808 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000007808 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000011927 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000002880 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000040843 | 1 retrocopy |
retro_mmus_2653 ,
|
| Ochotona princeps | ENSOPRG00000011313 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000005071 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000003048 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000018932 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014921 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000017081 | 3 retrocopies |