>retro_mmus_2441
CGAAAAGGATCCGGCCAGTCATGGCGTAGGTTAACAAAGGAAAGGGCAAAGCTTAATTGGCTCAGTGTGAACTTCAATAA
TTGGAAAGACTGGGAGGATGACTCAGATGAAGACATGTCGAATTTTGACCATTTCTCTGAGATGATGGATCACATGGGTG
GTGATGAGGATGTAGATTTACCAGAAGTAGATGGAGCAGATGATGATTCACAAGACAGTGATGATGAAAAGATGCCAGAT
CTGGAG
ORF - retro_mmus_2441 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: |
95.18 % |
| Parental protein coverage: |
51.88 % |
| Number of stop codons detected: |
0 |
| Number of frameshifts detected |
0 |
Retrocopy - Parental Gene Alignment:
| Parental | RKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMDHMGGDEDVDLPEVDGADDD |
| | RKG.SGQSW.RLTKERAKLNWLSV.FNNWKDWEDDSDEDMSNFD.FSEMMDHMGGDEDVDLPEVDGADDD |
| Retrocopy | RKG-SGQSWRRLTKERAKLNWLSVNFNNWKDWEDDSDEDMSNFDHFSEMMDHMGGDEDVDLPEVDGADDD |
|
| Parental | SQDSDDEKMPDLE |
| | SQDSDDEKMPDLE |
| Retrocopy | SQDSDDEKMPDLE |
|
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library |
Retrocopy expression |
Parental gene expression |
| SRP007412_brain |
0 .00 RPM |
35 .91 RPM |
| SRP007412_cerebellum |
0 .00 RPM |
29 .92 RPM |
| SRP007412_heart |
0 .03 RPM |
21 .36 RPM |
| SRP007412_kidney |
0 .02 RPM |
37 .94 RPM |
| SRP007412_liver |
0 .00 RPM |
40 .25 RPM |
| SRP007412_testis |
0 .05 RPM |
59 .87 RPM |
RNA Polymerase II actvity near the 5' end of retro_mmus_2441 was not detected
No EST(s) were mapped for retro_mmus_2441 retrocopy.
No TSS is located nearby retro_mmus_2441 retrocopy 5' end.
retro_mmus_2441 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_mmus_2441 has 0 orthologous retrocopies within eutheria group .
Parental genes homology:
Parental genes homology involve
24 parental genes, and
86 retrocopies.
| Species |
Parental gene accession |
Retrocopies number |
|
| Ailuropoda melanoleuca | ENSAMEG00000004172 | 1 retrocopy |
|
| Bos taurus | ENSBTAG00000017967 | 2 retrocopies |
|
| Choloepus hoffmanni | ENSCHOG00000006514 | 1 retrocopy |
|
| Callithrix jacchus | ENSCJAG00000010724 | 6 retrocopies |
|
| Cavia porcellus | ENSCPOG00000000057 | 2 retrocopies |
|
| Dasypus novemcinctus | ENSDNOG00000011310 | 4 retrocopies |
|
| Dipodomys ordii | ENSDORG00000000964 | 2 retrocopies |
|
| Echinops telfairi | ENSETEG00000000024 | 1 retrocopy |
|
| Homo sapiens | ENSG00000110958 | 5 retrocopies |
|
| Gorilla gorilla | ENSGGOG00000027957 | 5 retrocopies |
|
| Loxodonta africana | ENSLAFG00000008268 | 1 retrocopy |
|
| Macropus eugenii | ENSMEUG00000001288 | 1 retrocopy |
|
| Myotis lucifugus | ENSMLUG00000015927 | 3 retrocopies |
|
| Macaca mulatta | ENSMMUG00000013766 | 6 retrocopies |
|
| Mus musculus | ENSMUSG00000071072 | 2 retrocopies |
|
| Nomascus leucogenys | ENSNLEG00000017454 | 3 retrocopies |
|
| Otolemur garnettii | ENSOGAG00000028667 | 3 retrocopies |
|
| Procavia capensis | ENSPCAG00000007779 | 2 retrocopies |
|
| Pongo abelii | ENSPPYG00000004669 | 4 retrocopies |
|
| Pan troglodytes | ENSPTRG00000005108 | 8 retrocopies |
|
| Rattus norvegicus | ENSRNOG00000002642 | 5 retrocopies |
|
| Sorex araneus | ENSSARG00000007751 | 2 retrocopies |
|
| Tupaia belangeri | ENSTBEG00000002994 | 15 retrocopies |
retro_tbel_1658, retro_tbel_2266, retro_tbel_2370, retro_tbel_2383, retro_tbel_2598, retro_tbel_2622, retro_tbel_2823, retro_tbel_3798, retro_tbel_402, retro_tbel_407, retro_tbel_4279, retro_tbel_4432, retro_tbel_4461, retro_tbel_450, retro_tbel_997,
|