RetrogeneDB ID: | retro_mmus_1809 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 19:11958621..11958976(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | 1810009A15Rik | ||
| Ensembl ID: | ENSMUSG00000071653 | ||
| Aliases: | None | ||
| Description: | RIKEN cDNA 1810009A15 gene [Source:MGI Symbol;Acc:MGI:1913526] |
| Percent Identity: | 87.1 % |
| Parental protein coverage: | 99.19 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | APPGGKINRPRTELKKKLFKRRRVLSR-DRRRKRQVVGAVIDEGLTTKHHLKKRASSARANITLSGKKRR |
| APPGGKINRPR.ELKKKLF.RRRVLSR...RR...VVGAVID.GLT.KHHLKKRASSARANITLSGKK.R | |
| Retrocopy | APPGGKINRPRMELKKKLFRRRRVLSR<EKRR---VVGAVID*GLTMKHHLKKRASSARANITLSGKKHR |
| Parental | KLLQQIRLAQKEKAAMEVEAPS-KSTRTSQPQPKQQKKIKAPQDVAMEDLEDKS |
| KLLQQIRLAQKEKAAMEVE.PS.KSTRTSQ.QPKQQKKIKAPQD.AMED.EDKS | |
| Retrocopy | KLLQQIRLAQKEKAAMEVEDPS<KSTRTSQLQPKQQKKIKAPQDIAMEDHEDKS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .05 RPM | 7 .01 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 8 .51 RPM |
| SRP007412_heart | 0 .03 RPM | 9 .81 RPM |
| SRP007412_kidney | 0 .04 RPM | 13 .73 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .55 RPM |
| SRP007412_testis | 0 .05 RPM | 34 .72 RPM |
| ENCODE library ID | Target | ChIP-Seq Peak coordinates |
|---|---|---|
| ENCFF001YIJ | POLR2A | 19:11957349..11958332 |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_62618 | 561 libraries | 434 libraries | 75 libraries | 2 libraries | 0 libraries |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006512 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000010465 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000015719 | 2 retrocopies | |
| Felis catus | ENSFCAG00000025454 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000013949 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000071653 | 2 retrocopies |
retro_mmus_1809 , retro_mmus_759,
|
| Otolemur garnettii | ENSOGAG00000033103 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019701 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000023323 | 2 retrocopies |