RetrogeneDB ID: | retro_fcat_1722 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | E3:15155621..15155857(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000025454 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.9 % |
| Parental protein coverage: | 65.04 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | GLITRHHLKKRASSARANITLSGKKRRKLLQQIRLAQKEKAAMEVEAPTRQ-ARTSELQPKRQKKTKAPQ |
| GLI.R.H..KRAS.A...ITLSGKKRRKL.Q..R.AQ..KAAM.V..PTRQ.ARTSE.QPKRQKK...PQ | |
| Retrocopy | GLIARRHRTKRASRACTCITLSGKKRRKLPQRQR-AQEDKAAMGVAVPTRQ<ARTSEPQPKRQKKVNTPQ |
| Parental | DVDMEDLEDKS |
| .VDME.LE..S | |
| Retrocopy | EVDMENLENES |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 27 .43 RPM |
| SRP017611_kidney | 0 .00 RPM | 21 .13 RPM |
| SRP017611_liver | 0 .00 RPM | 9 .40 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006512 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000010465 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000015719 | 2 retrocopies | |
| Felis catus | ENSFCAG00000025454 | 2 retrocopies |
retro_fcat_1722 , retro_fcat_773,
|
| Macaca mulatta | ENSMMUG00000013949 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000071653 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000033103 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019701 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000023323 | 2 retrocopies |