RetrogeneDB ID: | retro_mmus_1683 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 18:6557129..6557558(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Chmp3 | ||
| Ensembl ID: | ENSMUSG00000053119 | ||
| Aliases: | Chmp3, 25.1, 4921505F14Rik, 9130011K15Rik, CGI-49, D6Ertd286e, NEDF, Vps24 | ||
| Description: | charged multivesicular body protein 3 [Source:MGI Symbol;Acc:MGI:1913950] |
| Percent Identity: | 94.41 % |
| Parental protein coverage: | 63.84 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAKEMIRS |
| MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEE.VKRSVKD.AKKGQKEVCVVLAKE.IRS | |
| Retrocopy | MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEEVKRSVKDEAKKGQKEVCVVLAKETIRS |
| Parental | RKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGII |
| RK.VSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKI.EIQATMRELSKEMMKAGII | |
| Retrocopy | RKTVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKILEIQATMRELSKEMMKAGII |
| Parental | EEM |
| ... | |
| Retrocopy | KDV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .05 RPM | 84 .41 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 76 .60 RPM |
| SRP007412_heart | 0 .12 RPM | 56 .59 RPM |
| SRP007412_kidney | 0 .02 RPM | 89 .74 RPM |
| SRP007412_liver | 0 .00 RPM | 57 .68 RPM |
| SRP007412_testis | 0 .09 RPM | 42 .67 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_60765 | 843 libraries | 200 libraries | 26 libraries | 1 library | 2 libraries |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000007479 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019406 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000001723 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000002851 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000009111 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005492 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000013134 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000009273 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000053119 | 1 retrocopy |
retro_mmus_1683 ,
|
| Oryctolagus cuniculus | ENSOCUG00000029277 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000002191 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000008917 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014743 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010400 | 1 retrocopy |