RetrogeneDB ID: | retro_mmul_1966 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 5:105527565..105527910(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | WRB | ||
| Ensembl ID: | ENSMMUG00000020654 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.14 % |
| Parental protein coverage: | 66.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFA |
| M..A.A..W.WLLVL.F.FGC.VL.ILLPSFS.FM.RV..KDA.QESQMRAEIQDMKQELS.VNMM..FA | |
| Retrocopy | MGMAKANCWVWLLVLRFLFGCRVLQILLPSFS-FMARVQRKDAKQESQMRAEIQDMKQELSAVNMMVKFA |
| Parental | RYARLERKINKMTDKLKTHVKARTAQLAKIKWVISVAFYVLQAALM |
| R.ARLERKINKMT.KLKTHVKA.TAQ...IKWV.SVAFY.L.A... | |
| Retrocopy | RSARLERKINKMTNKLKTHVKA*TAQSGMIKWVLSVAFYKLPATVI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 33 .50 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 31 .97 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 35 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 12 .66 RPM |
| SRP007412_kidney | 0 .00 RPM | 20 .07 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .93 RPM |
| SRP007412_testis | 0 .00 RPM | 18 .88 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3080 |
| Pan troglodytes | retro_ptro_2078 |
| Pongo abelii | retro_pabe_2552 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000005714 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000024987 | 1 retrocopy | |
| Homo sapiens | ENSG00000182093 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013144 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000015808 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020654 | 2 retrocopies |
retro_mmul_1966 , retro_mmul_853,
|
| Mus musculus | ENSMUSG00000023147 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013146 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000026761 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000011427 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013915 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000012736 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015373 | 1 retrocopy |