RetrogeneDB ID: | retro_dnov_1496 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_21889:129..468(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000024987 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.26 % |
| Parental protein coverage: | 64.37 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | MCAAEADRWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQEAQMRAEIQGMKQELSTVNMMDEFA |
| ...A.A..WAWLL.LSF.F.C.VLR..L....SFMSR.LQK..EQEA.MRAEIQGMKQEL.TVNMMDEF. | |
| Retrocopy | LSTAKANCWAWLLILSFMF*CKVLRPPLVILFSFMSRLLQKHVEQEAHMRAEIQGMKQELTTVNMMDEFV |
| Parental | RYARLERKINK-MTDKLKTHVKARTAQLAKIKWVISVAFYVLQ |
| RYARLERKIN...TD.LKT...A..AQ..KIK.VISVA.Y..Q | |
| Retrocopy | RYARLERKINRWITDNLKTQMNAWMAQISKIK*VISVALYASQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 4 .08 RPM |
| SRP012922_cerebellum | 0 .55 RPM | 12 .65 RPM |
| SRP012922_heart | 0 .00 RPM | 5 .34 RPM |
| SRP012922_kidney | 0 .00 RPM | 4 .93 RPM |
| SRP012922_liver | 0 .00 RPM | 4 .80 RPM |
| SRP012922_lung | 0 .00 RPM | 10 .84 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 5 .02 RPM |
| SRP012922_spleen | 0 .00 RPM | 7 .67 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000005714 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000024987 | 1 retrocopy |
retro_dnov_1496 ,
|
| Homo sapiens | ENSG00000182093 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013144 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000015808 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020654 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000023147 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013146 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000026761 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000011427 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013915 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000012736 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015373 | 1 retrocopy |