RetrogeneDB ID: | retro_mmul_1094 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 14:15746507..15746801(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ENY2 | ||
| Ensembl ID: | ENSMMUG00000006104 | ||
| Aliases: | None | ||
| Description: | enhancer of yellow 2 transcription factor homolog [Source:RefSeq peptide;Acc:NP_001252832] |
| Percent Identity: | 91.92 % |
| Parental protein coverage: | 98.02 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | VVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEI |
| VVSKMNKDAQMR.AINQKLIETGERE..KELLRAKLIE.GWKDQLKAHCKEVIKE.GLEHVTVDDLVAEI | |
| Retrocopy | VVSKMNKDAQMRGAINQKLIETGERECFKELLRAKLIE*GWKDQLKAHCKEVIKEQGLEHVTVDDLVAEI |
| Parental | TPKGRALVPDSVKKELLQRIRTFLAQHAS |
| TPKGR.LVPDSVKKE.L.RIRTFLAQHAS | |
| Retrocopy | TPKGRTLVPDSVKKE-LERIRTFLAQHAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .34 RPM | 9 .08 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .16 RPM | 11 .58 RPM |
| SRP007412_cerebellum | 0 .26 RPM | 5 .94 RPM |
| SRP007412_heart | 0 .06 RPM | 19 .55 RPM |
| SRP007412_kidney | 0 .12 RPM | 19 .25 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .00 RPM |
| SRP007412_testis | 0 .11 RPM | 18 .73 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pongo abelii | retro_pabe_750 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000003039 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000006389 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000010988 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007377 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010882 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000012948 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000027585 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006104 | 2 retrocopies |
retro_mmul_1094 , retro_mmul_1490,
|
| Pongo abelii | ENSPPYG00000025888 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000001787 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000000273 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001742 | 3 retrocopies |