RetrogeneDB ID: | retro_cjac_1355 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 15:77272266..77272569(+) | ||
| Located in intron of: | ENSCJAG00000008949 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ENY2 | ||
| Ensembl ID: | ENSCJAG00000006389 | ||
| Aliases: | None | ||
| Description: | enhancer of yellow 2 homolog (Drosophila) [Source:HGNC Symbol;Acc:24449] |
| Percent Identity: | 92.08 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAE |
| .VVSKMNKDAQM.AAINQKLIETGERE.LKEL.RAKL.ECGWK.QLK.HCKEVIKEKGLEHVTVDDLVAE | |
| Retrocopy | LVVSKMNKDAQMTAAINQKLIETGERECLKELPRAKLTECGWKGQLKSHCKEVIKEKGLEHVTVDDLVAE |
| Parental | ITPKGRALVPDSVKKELLQRIRTFLAQHASL |
| ITPKGR.LVPDSVKKELLQRIRTFLAQHASL | |
| Retrocopy | ITPKGRGLVPDSVKKELLQRIRTFLAQHASL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .09 RPM | 6 .99 RPM |
| SRP051959_heart | 0 .65 RPM | 8 .21 RPM |
| SRP051959_kidney | 0 .16 RPM | 15 .49 RPM |
| SRP051959_liver | 0 .30 RPM | 15 .68 RPM |
| SRP051959_lung | 2 .15 RPM | 7 .34 RPM |
| SRP051959_lymph_node | 0 .73 RPM | 6 .21 RPM |
| SRP051959_skeletal_muscle | 0 .15 RPM | 9 .19 RPM |
| SRP051959_spleen | 1 .58 RPM | 9 .35 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000003039 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000006389 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000010988 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007377 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010882 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000012948 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000027585 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006104 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000025888 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000001787 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000000273 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001742 | 3 retrocopies |