RetrogeneDB ID: | retro_cpor_927 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_35:14957868..14958051(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ENY2 | ||
| Ensembl ID: | ENSCPOG00000010988 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.69 % |
| Parental protein coverage: | 60.4 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 0 |
| Parental | VSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVT |
| VS.MNKD.QMRAAINQKLIETGERE.L.ELLRAKLIECG.KDQ.K....E.IKE..LEHVT | |
| Retrocopy | VS*MNKDVQMRAAINQKLIETGEREGLTELLRAKLIECG*KDQVKPYYIEAIKEQ*LEHVT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 15 .99 RPM |
| SRP017611_kidney | 0 .00 RPM | 23 .45 RPM |
| SRP017611_liver | 0 .00 RPM | 19 .85 RPM |
| SRP040447_lung | 0 .00 RPM | 14 .50 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 12 .36 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000003039 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000006389 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000010988 | 1 retrocopy |
retro_cpor_927 ,
|
| Dasypus novemcinctus | ENSDNOG00000007377 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010882 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000012948 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000027585 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006104 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000025888 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000001787 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000000273 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001742 | 3 retrocopies |