RetrogeneDB ID: | retro_mluc_2526 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL430716:22717..23091(+) | ||
| Located in intron of: | ENSMLUG00000007550 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C9ORF85 | ||
| Ensembl ID: | ENSMLUG00000024309 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.22 % |
| Parental protein coverage: | 78.48 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | TVQTKKINTKLHDGVCQRCKEVLEWRVKYSK-YKPLSKPKKCVKCLQKTVKDSY-HIICRPCACELEVCA |
| .VQTKKINTKL.D.VCQRCKEVL.WRVKYSK..K...K..K......K.......H...RPCACEL.VCA | |
| Retrocopy | SVQTKKINTKLLDEVCQRCKEVLKWRVKYSK<IKTIVKALKMCEMFTKDSERFFSHNV*RPCACELKVCA |
| Parental | KCGKKEDIVTPFNKEPEKTENIENNPHSNCRRSCRRNKEESDDLDFSIDLDDSEED |
| KCGKKEDIVTPFNKEPEKTENI.NNPHSN..RSCRRNKEESDDLDF.IDLDD...D | |
| Retrocopy | KCGKKEDIVTPFNKEPEKTENI*NNPHSNYKRSCRRNKEESDDLDFDIDLDDNQID |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000007254 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000006831 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000001820 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001441 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000025848 | 2 retrocopies | |
| Felis catus | ENSFCAG00000031942 | 1 retrocopy | |
| Homo sapiens | ENSG00000155621 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000024309 | 2 retrocopies |
retro_mluc_2449, retro_mluc_2526 ,
|
| Macaca mulatta | ENSMMUG00000018881 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000008971 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000035171 | 6 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001023 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000024578 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000011302 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000029745 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000021018 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000027161 | 5 retrocopies | |
| Sorex araneus | ENSSARG00000004523 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000015556 | 6 retrocopies |