RetrogeneDB ID: | retro_mdom_1669 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 6:112809485..112809866(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V0C | ||
| Ensembl ID: | ENSMODG00000015439 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c [Source:HGNC Symbol;Acc:855] |
| Percent Identity: | 98.43 % |
| Parental protein coverage: | 69.78 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | PSVLYPLPSPVPLPLSPRPVHLPAYRPRADMSEAPEYASFFAIMGASAAMVFSALGAAYGTAKSGTGIAA |
| PSVLYP.PSPVPLPLSPRPVHLPAYRPRADMSEAPEYASFFAIMGASAAMVFSALGAAYGTAKSGTGIAA | |
| Retrocopy | PSVLYPPPSPVPLPLSPRPVHLPAYRPRADMSEAPEYASFFAIMGASAAMVFSALGAAYGTAKSGTGIAA |
| Parental | MSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANAVTPAITLFKSFLQLGAGLSVG |
| MSVM.PELIMKSIIPVVMAGIIAIYGLVVAVLIANAVTPAITLFKSFLQLGAGLSVG | |
| Retrocopy | MSVM*PELIMKSIIPVVMAGIIAIYGLVVAVLIANAVTPAITLFKSFLQLGAGLSVG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000026428 | 1 retrocopy | |
| Homo sapiens | ENSG00000185883 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028600 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000004597 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000026715 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000015439 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000024121 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009416 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000015060 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007653 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000006542 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000014251 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013420 | 3 retrocopies | |
| Drosophila melanogaster | FBgn0262736 | 3 retrocopies | |
| Caenorhabditis elegans | R10E11.2 | 2 retrocopies |