RetrogeneDB ID: | retro_mdom_1058 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 3:439062444..439062734(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NUDCD2 | ||
| Ensembl ID: | ENSMODG00000007641 | ||
| Aliases: | None | ||
| Description: | NudC domain containing 2 [Source:HGNC Symbol;Acc:30535] |
| Percent Identity: | 81.63 % |
| Parental protein coverage: | 50.79 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | TPWGQWYQTLEEVFI-EVQVPPGTRAQEIQCGLQSRHVELAVRGQEILKGKLFDSTIADEGTWTLEDRKM |
| T.WG.WYQTLEE.FI..VQVPP.T..QEIQ..LQS.HVEL.V..QEILKGKLFDSTIADEGTWTLEDRK. | |
| Retrocopy | TTWGHWYQTLEEMFI<QVQVPPCTHLQEIQGDLQSQHVELVVQSQEILKGKLFDSTIADEGTWTLEDRKI |
| Parental | VRIVLTKTKRDAANCWTSLLETEYAADP |
| ..IVLTKTKRDAANC.TSLLETEYAADP | |
| Retrocopy | AYIVLTKTKRDAANCLTSLLETEYAADP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 26 .46 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 18 .61 RPM |
| SRP007412_heart | 0 .00 RPM | 20 .93 RPM |
| SRP007412_kidney | 0 .00 RPM | 19 .75 RPM |
| SRP007412_liver | 0 .00 RPM | 30 .71 RPM |
| SRP007412_testis | 0 .00 RPM | 25 .14 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005270 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000014772 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000015367 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000000877 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000014291 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000004802 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000001670 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000007641 | 2 retrocopies |
retro_mdom_1058 , retro_mdom_2016,
|
| Ornithorhynchus anatinus | ENSOANG00000021414 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005783 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000024929 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000007551 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000028665 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000307 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000008090 | 1 retrocopy |