RetrogeneDB ID: | retro_cjac_2093 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 22:13782024..13782302(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCJAG00000004673 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NUDCD2 | ||
| Ensembl ID: | ENSCJAG00000015367 | ||
| Aliases: | None | ||
| Description: | NudC domain containing 2 [Source:HGNC Symbol;Acc:30535] |
| Percent Identity: | 89.36 % |
| Parental protein coverage: | 59.24 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALAVGGREILKGKLFD-S |
| MSAPFEE.S.VV.CGTPWGQWYQTLEEVFIEVQVPPGT..QDIQCGLQS.HVALAVGG.EILKGKLFD.S | |
| Retrocopy | MSAPFEEQSRVVLCGTPWGQWYQTLEEVFIEVQVPPGTCTQDIQCGLQSQHVALAVGGHEILKGKLFD<S |
| Parental | TIADEGTWTLEDRKMVRIVLTKTK |
| TIADEGTWTLEDRKMVRIVLTK.. | |
| Retrocopy | TIADEGTWTLEDRKMVRIVLTKAE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 6 .48 RPM |
| SRP051959_heart | 0 .02 RPM | 5 .21 RPM |
| SRP051959_kidney | 0 .00 RPM | 7 .83 RPM |
| SRP051959_liver | 0 .00 RPM | 9 .21 RPM |
| SRP051959_lung | 0 .03 RPM | 6 .77 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 7 .90 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 6 .14 RPM |
| SRP051959_spleen | 0 .02 RPM | 7 .58 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005270 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000014772 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000015367 | 1 retrocopy |
retro_cjac_2093 ,
|
| Cavia porcellus | ENSCPOG00000000877 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000014291 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000004802 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000001670 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000007641 | 2 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000021414 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005783 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000024929 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000007551 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000028665 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000307 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000008090 | 1 retrocopy |