RetrogeneDB ID: | retro_lafr_636 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
| Coordinates: | scaffold_27:16460843..16461084(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NME1-NME2 | ||
| Ensembl ID: | ENSLAFG00000007784 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.86 % |
| Parental protein coverage: | 53.95 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | VQRGLVGDIIKRFEQKGFRLVAMKFVQ-ASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWE-GLNV |
| V.R...G.I.K..E.KGFRLV.MKF...A...HL.QHY..LKD.PFFPGL.KY.NS.PVVAMVWE.GL.V | |
| Retrocopy | VRRSPLGEIVKHLEPKGFRLVVMKFLG<ACKKHLQQHYVNLKDCPFFPGL-KYVNSEPVVAMVWE<GLKV |
| Parental | VKTGRVMLGETNPA |
| VKTG.VM.GETNPA | |
| Retrocopy | VKTGQVMRGETNPA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008022 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000047186 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021658 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000003783 | 2 retrocopies | |
| Felis catus | ENSFCAG00000006742 | 5 retrocopies | |
| Homo sapiens | ENSG00000011052 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000007784 | 1 retrocopy |
retro_lafr_636 ,
|
| Myotis lucifugus | ENSMLUG00000016929 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000001940 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015573 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000020857 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000002671 | 8 retrocopies | |
| Sus scrofa | ENSSSCG00000017591 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013053 | 6 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007433 | 1 retrocopy |