RetrogeneDB ID: | retro_ecab_404 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 17:2767903..2768311(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NME2 | ||
| Ensembl ID: | ENSECAG00000021658 | ||
| Aliases: | None | ||
| Description: | nucleoside diphosphate kinase B [Source:RefSeq peptide;Acc:NP_001191672] |
| Percent Identity: | 57.45 % |
| Parental protein coverage: | 60.79 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 3 |
| Parental | QVGRTMANVERTFIAIKPDGVQRSLVGEIIKRFEQK-GFRLVAMKLLQASEDLLKQHYVDLKDRPFFPGL |
| Q...TMAN.E..FIA.K.D.VQ..L.GEI.K.F.QK.GF.L...K..QASED.LKQHYV.LKD..FF..L | |
| Retrocopy | QQEQTMANSEGIFIASKFDQVQGRLMGEILKHFQQK<GFQLIGLKFMQASEDVLKQHYVILKDGLFFANL |
| Parental | VKYMHSGPIVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDF-CIQVGRNIIHGSDS-VKSAEKEISL |
| VK.M..GP.V.M..EGLNVVKT...ML.ET.......G...G.F.CIQV.RNII.GS.S...SAEK...L | |
| Retrocopy | VKDMYTGPVVVMR*EGLNVVKTCWIMLRETYLWALSLGPSLGMF<CIQVDRNIIYGSNS<LQSAEK-TGL |
| Parental | W |
| W | |
| Retrocopy | W |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 51 .53 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 71 .20 RPM |
| SRP021940_embryo | 0 .05 RPM | 104 .67 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 89 .53 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 135 .26 RPM |
| SRP021940_testis | 0 .00 RPM | 48 .98 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008022 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000047186 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021658 | 1 retrocopy |
retro_ecab_404 ,
|
| Erinaceus europaeus | ENSEEUG00000003783 | 2 retrocopies | |
| Felis catus | ENSFCAG00000006742 | 5 retrocopies | |
| Homo sapiens | ENSG00000011052 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000007784 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016929 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000001940 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015573 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000020857 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000002671 | 8 retrocopies | |
| Sus scrofa | ENSSSCG00000017591 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013053 | 6 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007433 | 1 retrocopy |