RetrogeneDB ID: | retro_itri_240 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393281.1:12586363..12586588(+) | ||
| Located in intron of: | ENSSTOG00000000280 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MRPL17 | ||
| Ensembl ID: | ENSSTOG00000003313 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein L17 [Source:HGNC Symbol;Acc:14053] |
| Percent Identity: | 72. % |
| Parental protein coverage: | 60.66 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 0 |
| Parental | HERIEASWARVDEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFQVLAPRFQDQNGGYTR-M |
| .E.I..SW.RVD.MRGY.E..ID.GKL.DTN..AM.MADFWLTEKD.IPK.FQVL.P.FQ.QNGGYTR.. | |
| Retrocopy | NE*IQVSWVRVDKMRGYSEEFID*GKLRDTNK*AMSMADFWLTEKDSIPKQFQVLTPQFQYQNGGYTRTL |
| Parental | LQIPN |
| LQIPN | |
| Retrocopy | LQIPN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000027536 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000013588 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000001144 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000005449 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019497 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000024693 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003313 | 3 retrocopies |
retro_itri_1019, retro_itri_1156, retro_itri_240 ,
|