RetrogeneDB ID: | retro_itri_1443 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393488.1:1736112..1736511(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RNF138 | ||
| Ensembl ID: | ENSSTOG00000002293 | ||
| Aliases: | None | ||
| Description: | ring finger protein 138, E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:17765] |
| Percent Identity: | 51.09 % |
| Parental protein coverage: | 54.51 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 4 |
| Parental | PVCQEVLKTPVR-TAACQHVFCR-KCFLTAMRESGIHCPLCRGNVTRRERACPERALDLENIMRKFSGSC |
| P.C.EVL.T..R.....QH.FC..K...T..RE.......C....TRR...C.E..L..EN..R.FS.SC | |
| Retrocopy | PLCPEVLETLCR<RMTWQHFFCN>KMCPTEIRERVLNHHICHQTSTRRKKSCLE*TLHIENVTREFSSSC |
| Parental | RCCA-KQIKFYRMRHHYKSCKKYQDEYGVSSIIPNFQISQDSVGN-SNRSETSTSDNTETYQENTSS |
| .CC..KQIKF.R.R.HYKS.KK.QDEY...SIIP..QISQ.S.GN..NRSET.TSD.......NT.S | |
| Retrocopy | GCCK<KQIKF*RKRYHYKSYKKDQDEYSAASIIPTSQISQGSAGN>LNRSETFTSDSMGNSPGNTQS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000020160 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000012689 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020875 | 1 retrocopy | |
| Felis catus | ENSFCAG00000014180 | 2 retrocopies | |
| Homo sapiens | ENSG00000134758 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027857 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003811 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000010850 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000006982 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006401 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009094 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000009956 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000003778 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000015645 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000002293 | 2 retrocopies |
retro_itri_1443 , retro_itri_576,
|