RetrogeneDB ID: | retro_ggor_990 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 13:24442415..24442811(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSGGOG00000028161 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FABP3 | ||
| Ensembl ID: | ENSGGOG00000014432 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 83.33 % |
| Parental protein coverage: | 99.25 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVE |
| MVDAFL.TWKL.DSKNFDDYMK..G..FA.RQVASMTKPTTII.KNGDI.TLKTHS.FKN.EISFKLG.. | |
| Retrocopy | MVDAFLCTWKLSDSKNFDDYMKLIGASFAIRQVASMTKPTTIIKKNGDIITLKTHSVFKNAEISFKLGMG |
| Parental | FDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKE |
| FDETTADD.KVKSIVTLDGGK.VHLQK..GQE.TLV.EL.DGKLILTLT.GTAV.TRTYEKE | |
| Retrocopy | FDETTADDKKVKSIVTLDGGKPVHLQKCNGQERTLVPELSDGKLILTLTQGTAVYTRTYEKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 99 .79 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 25 .88 RPM |
| SRP007412_heart | 0 .00 RPM | 750 .85 RPM |
| SRP007412_kidney | 0 .00 RPM | 266 .35 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .63 RPM |
| SRP007412_testis | 0 .00 RPM | 72 .11 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1258 |
| Pan troglodytes | retro_ptro_3047 |
| Pongo abelii | retro_pabe_1048 |
| Macaca mulatta | retro_mmul_1311 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016819 | 2 retrocopies | |
| Danio rerio | ENSDARG00000023290 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000511 | 2 retrocopies | |
| Equus caballus | ENSECAG00000024852 | 1 retrocopy | |
| Homo sapiens | ENSG00000121769 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000005964 | 8 retrocopies | |
| Gorilla gorilla | ENSGGOG00000014432 | 1 retrocopy |
retro_ggor_990 ,
|
| Gorilla gorilla | ENSGGOG00000016835 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025475 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012501 | 6 retrocopies | |
| Microcebus murinus | ENSMICG00000009359 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013609 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000028773 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001586 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013757 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000001616 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000457 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012879 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003842 | 3 retrocopies |