RetrogeneDB ID: | retro_pabe_1048 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 13:42361815..42362211(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FABP3 | ||
| Ensembl ID: | ENSPPYG00000001616 | ||
| Aliases: | None | ||
| Description: | fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) [Source:HGNC Symbol;Acc:3557] |
| Percent Identity: | 83.33 % |
| Parental protein coverage: | 99.25 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVE |
| MVDAFL.TWKL.DSKNFDDYMK..G..FATRQVAS.TKPTT.I.KNGDI.TLKT.S.FKNTEISFKLG.E | |
| Retrocopy | MVDAFLCTWKLSDSKNFDDYMKLIGASFATRQVASVTKPTTVIKKNGDIITLKTQSMFKNTEISFKLGME |
| Parental | FDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKE |
| FDETTADD.KVKSIVTLDGGKLVHLQK..GQE.T.V.EL.DGKLILTLT.GTAV.TRTYEKE | |
| Retrocopy | FDETTADDKKVKSIVTLDGGKLVHLQKCNGQERTFVSELSDGKLILTLTQGTAVYTRTYEKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 106 .82 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 44 .26 RPM |
| SRP007412_heart | 0 .03 RPM | 1415 .50 RPM |
| SRP007412_kidney | 0 .00 RPM | 152 .51 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .79 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1258 |
| Pan troglodytes | retro_ptro_3047 |
| Gorilla gorilla | retro_ggor_990 |
| Macaca mulatta | retro_mmul_1311 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016819 | 2 retrocopies | |
| Danio rerio | ENSDARG00000023290 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000511 | 2 retrocopies | |
| Equus caballus | ENSECAG00000024852 | 1 retrocopy | |
| Homo sapiens | ENSG00000121769 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000014432 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012501 | 6 retrocopies | |
| Microcebus murinus | ENSMICG00000009359 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013609 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000028773 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001586 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013757 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000001616 | 1 retrocopy |
retro_pabe_1048 ,
|
| Pongo abelii | ENSPPYG00000016979 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018699 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018703 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000457 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012879 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003842 | 3 retrocopies |