RetrogeneDB ID: | retro_ggor_946 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 13:59662914..59663286(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | BTF3 | ||
| Ensembl ID: | ENSGGOG00000000166 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.6 % |
| Parental protein coverage: | 61.17 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | ATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSI |
| A.A.DKK.QFSLKKLGVNNIS.IEEVNMFT.QGTVIHFNNP.VQASLAANTFT.TGHAETKQLTEML.S. | |
| Retrocopy | AIAEDKKFQFSLKKLGVNNISDIEEVNMFTHQGTVIHFNNPEVQASLAANTFTMTGHAETKQLTEMLLSF |
| Parental | LNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN |
| .............R....LPKQSV.GKAPLATGE..DDEV.DLVEN.DEAS.NEAN | |
| Retrocopy | DHKPVLQMV*LVQRDWLTLPKQSVGGKAPLATGE--DDEVLDLVENSDEASNNEAN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 60 .76 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 67 .41 RPM |
| SRP007412_heart | 0 .00 RPM | 37 .71 RPM |
| SRP007412_kidney | 0 .00 RPM | 133 .91 RPM |
| SRP007412_liver | 0 .00 RPM | 95 .94 RPM |
| SRP007412_testis | 0 .00 RPM | 119 .04 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1215 |
| Pan troglodytes | retro_ptro_832 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000010012 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000016600 | 4 retrocopies | |
| Ciona savignyi | ENSCSAVG00000009653 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021629 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000017341 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000166 | 10 retrocopies |
retro_ggor_1082, retro_ggor_1682, retro_ggor_1961, retro_ggor_2054, retro_ggor_2399, retro_ggor_2647, retro_ggor_2667, retro_ggor_548, retro_ggor_81, retro_ggor_946 ,
|
| Microcebus murinus | ENSMICG00000017182 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000001762 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004718 | 9 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000024914 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000029576 | 14 retrocopies | |
| Rattus norvegicus | ENSRNOG00000016912 | 9 retrocopies |