RetrogeneDB ID: | retro_ggor_794 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 12:46465545..46465895(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | BOD1 | ||
| Ensembl ID: | ENSGGOG00000010925 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.49 % |
| Parental protein coverage: | 63.24 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | GLFDSFRRDCLADVDTKPAYQN-LRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLRQSVVQSGMLEAGVDR |
| G.F.SFRR.CLA..DTKPAYQN.LRQK....VSTHLDKQEW.PTM.KN.LR.GLRQSV.QSG.L.AGVD. | |
| Retrocopy | GPFSSFRRCCLAPADTKPAYQN<LRQKAQHSVSTHLDKQEWDPTMRKN*LRSGLRQSVFQSGTLKAGVDG |
| Parental | IISQVVDPKLNHIFRPQIERAIHEFLAAQKKAAVPAPPPEPEGQDPPA |
| ...Q.VDP.LNHI.RP..E.AIHE.L..QK.A.VP.PP.EP..QDPPA | |
| Retrocopy | VLYQMVDPELNHIPRPPVE*AIHEILGDQKTAMVPVPPAEPKDQDPPA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 28 .92 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 21 .08 RPM |
| SRP007412_heart | 0 .00 RPM | 11 .91 RPM |
| SRP007412_kidney | 0 .00 RPM | 34 .76 RPM |
| SRP007412_liver | 0 .00 RPM | 21 .13 RPM |
| SRP007412_testis | 0 .21 RPM | 50 .87 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_993 |
| Pan troglodytes | retro_ptro_757 |
| Macaca mulatta | retro_mmul_803 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000034598 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000016776 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000031971 | 4 retrocopies | |
| Homo sapiens | ENSG00000145919 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010925 | 2 retrocopies |
retro_ggor_1365, retro_ggor_794 ,
|
| Microcebus murinus | ENSMICG00000002626 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013793 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000044502 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000476 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000014283 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001107 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000016057 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000017544 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000013505 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014046 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007617 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000384 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000004260 | 1 retrocopy |