RetrogeneDB ID: | retro_ggor_638 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 11:33280404..33280635(+) | ||
| Located in intron of: | ENSGGOG00000002801 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSGGOG00000007650 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.32 % |
| Parental protein coverage: | 60.16 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | RGRCLQALRMVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRP |
| .G..L.AL.MVQ.LTY...LSYNTASNKTRLS.TPGNRIVYLYTKKVGKAPKS..G..P.R..GV.AVR. | |
| Retrocopy | QGWHLDALKMVQHLTYHHGLSYNTASNKTRLSQTPGNRIVYLYTKKVGKAPKSPRGMPPSRFQGVCAVRR |
| Parental | KVLMRLS |
| KVLMRLS | |
| Retrocopy | KVLMRLS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 67 .14 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 96 .60 RPM |
| SRP007412_heart | 0 .03 RPM | 42 .96 RPM |
| SRP007412_kidney | 0 .04 RPM | 227 .51 RPM |
| SRP007412_liver | 0 .40 RPM | 244 .87 RPM |
| SRP007412_testis | 0 .00 RPM | 93 .24 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_769 |
| Pan troglodytes | retro_ptro_538 |