RetrogeneDB ID: | retro_ggor_331 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:184198851..184199260(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C12ORF45 | ||
| Ensembl ID: | ENSGGOG00000027272 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.5 % |
| Parental protein coverage: | 72.97 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | HGKPQASPSC-SSPTRDSS-GVPVSKELLTAGSDGRGGIWDRLLINSQPKSRKTSTLQTVRIERSPLLDQ |
| H.KPQAS.S....P.R....G..V.KE.LT.G....GGI.DRLLINSQ..SRK.ST.Q.V.I.RSPL.DQ | |
| Retrocopy | HRKPQASSSS>CCPLRTATEGALVPKEWLTVGNNSQGGISDRLLINSQFDSRKNSTIQPVQIQRSPLVDQ |
| Parental | VQTFLPQMARANEKLRKEMAAAPPGRFNIENIDGPHSKVIQMDVALFEMNQSDSKEADSSEESSQDS |
| .QTFLPQMA.A.EKLRK.MA..P.G.FNIENIDG...KVIQMDV.LFEMNQS.SK...S..E...DS | |
| Retrocopy | GQTFLPQMAQAHEKLRK*MAGSPSGCFNIENIDGSLRKVIQMDVVLFEMNQSNSKVNSSESEDEDDS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .35 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .85 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .13 RPM |
| SRP007412_kidney | 0 .16 RPM | 4 .01 RPM |
| SRP007412_liver | 0 .03 RPM | 3 .19 RPM |
| SRP007412_testis | 0 .00 RPM | 2 .49 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_292 |
| Pan troglodytes | retro_ptro_240 |
| Pongo abelii | retro_pabe_382 |
| Macaca mulatta | retro_mmul_551 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000014728 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017235 | 1 retrocopy | |
| Homo sapiens | ENSG00000151131 | 1 retrocopy | |
| Gallus gallus | ENSGALG00000012694 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027272 | 1 retrocopy |
retro_ggor_331 ,
|
| Macaca mulatta | ENSMMUG00000017133 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006584 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004897 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005381 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000027792 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000005714 | 1 retrocopy |