RetrogeneDB ID: | retro_ggor_2936 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | X:86087255..86087640(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | UBE2D4 | ||
| Ensembl ID: | ENSGGOG00000003378 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 65.44 % |
| Parental protein coverage: | 89.12 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 4 |
| Parental | MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGG-VFFLTIHFPTDYPFKPPKVAF |
| M.LK.I.KE.......P.AQCS...VG.D.FHWQATI.GP..S.YQGG.VFFLT.HF..DY.FKPPKVAF | |
| Retrocopy | M*LKQINKEFRFFVLGPLAQCS---VGCDSFHWQATIIGPHYSLYQGG>VFFLTVHFHSDYSFKPPKVAF |
| Parental | TTKIYHPNI-NSNGSICLDILRSQWSPALT-VSKVLL-SICSLLCDPNPD-DPLVPEIAHTYKADR |
| .T.IYHPNI..SN..ICL.ILRS.WS.ALT...KV...SICSLLCDPNP...PLV.EIA.TYK.D. | |
| Retrocopy | ITRIYHPNI<LSNETICLSILRSLWSSALT<IFKVIFTSICSLLCDPNPE<NPLVLEIARTYKTDK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 28 .01 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 24 .62 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .57 RPM |
| SRP007412_kidney | 0 .00 RPM | 23 .96 RPM |
| SRP007412_liver | 0 .00 RPM | 17 .01 RPM |
| SRP007412_testis | 0 .00 RPM | 17 .92 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4725 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003997 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007875 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000006888 | 5 retrocopies | |
| Homo sapiens | ENSG00000078967 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001368 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000003378 | 3 retrocopies |
retro_ggor_1843, retro_ggor_2936 , retro_ggor_436,
|
| Gorilla gorilla | ENSGGOG00000008393 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000010832 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000028073 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011919 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000002410 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003364 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008900 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000029727 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000016722 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000003691 | 9 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000595 | 14 retrocopies |