RetrogeneDB ID: | retro_ocun_1058 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 2:99668536..99668930(+) | ||
| Located in intron of: | ENSOCUG00000029173 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | UBE2D4 | ||
| Ensembl ID: | ENSOCUG00000008900 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2D 4 (putative) [Source:HGNC Symbol;Acc:21647] |
| Percent Identity: | 65.25 % |
| Parental protein coverage: | 93.29 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | ELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPTDSPYQGGLFFLTIHFPTDY-PFKPPKVAFTTKIYHPN |
| ELTDLQR..PAQCS...V..DLFH.QATIMG....PYQGG.FFLTIHF.T...PFKPPKVA.TT...H.N | |
| Retrocopy | ELTDLQR-APAQCSI--VSNDLFHGQATIMG---LPYQGGVFFLTIHFLTND<PFKPPKVALTTEMHHYN |
| Parental | INSNGSICLDILRSQWSPALTVSK-VLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYA |
| .N.N.SICL.IL.SQWSP.L......L...C.L...PNPDD.LV.EIAH.YKA.RE.Y.RLARE.TQKYA | |
| Retrocopy | VNCNDSICLHILQSQWSPELCPKS<LLSICCLLF-NPNPDDSLVSEIAHIYKAVREMYSRLARE*TQKYA |
| Parental | L |
| . | |
| Retrocopy | I |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .22 RPM | 38 .19 RPM |
| SRP017611_kidney | 0 .00 RPM | 14 .60 RPM |
| SRP017611_liver | 0 .00 RPM | 7 .25 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003997 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007875 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000006888 | 5 retrocopies | |
| Homo sapiens | ENSG00000078967 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000003378 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011919 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000002410 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003364 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000002610 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006026 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008900 | 1 retrocopy |
retro_ocun_1058 ,
|
| Oryctolagus cuniculus | ENSOCUG00000029448 | 10 retrocopies | |
| Pongo abelii | ENSPPYG00000029727 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000016722 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000003691 | 9 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000595 | 14 retrocopies |