RetrogeneDB ID: | retro_ggor_2866 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 9:76453598..76454043(-) | ||
| Located in intron of: | ENSGGOG00000008483 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | YRDC | ||
| Ensembl ID: | ENSGGOG00000007619 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.52 % |
| Parental protein coverage: | 53.05 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | CRVRVPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLV-GIRIPDHAFMQDLAQMFEGPLALTSANLSS |
| C...VP..LLKDL.PGPV.LVMERSEELN.DLNPFTPL..GIRIPD.AFMQDLA.M.E.PLALTSANLSS | |
| Retrocopy | CMRVVPQELLKDLVPGPVSLVMERSEELNNDLNPFTPLT>GIRIPDYAFMQDLATMYEHPLALTSANLSS |
| Parental | QASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYG |
| Q.SSLN..E..DLWPQLSLVIDGGQ..D.Q.PEC..GSTVVDLSV..KFGIIRPGC.LESTTA.LQQ.YG | |
| Retrocopy | QDSSLNAMEL*DLWPQLSLVIDGGQTRDSQIPECCFGSTVVDLSVHRKFGIIRPGCVLESTTAFLQQRYG |
| Parental | LLPSHASYL |
| L.PS.ASYL | |
| Retrocopy | LHPSCASYL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 7 .29 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 8 .23 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .81 RPM |
| SRP007412_kidney | 0 .00 RPM | 7 .65 RPM |
| SRP007412_liver | 0 .03 RPM | 6 .83 RPM |
| SRP007412_testis | 0 .10 RPM | 14 .50 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001173 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009111 | 2 retrocopies | |
| Equus caballus | ENSECAG00000022522 | 1 retrocopy | |
| Felis catus | ENSFCAG00000011018 | 1 retrocopy | |
| Homo sapiens | ENSG00000196449 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007619 | 1 retrocopy |
retro_ggor_2866 ,
|
| Macropus eugenii | ENSMEUG00000005068 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000011953 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000000955 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005372 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000011665 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030474 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001523 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000557 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000008863 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000005555 | 3 retrocopies |