RetrogeneDB ID: | retro_ggor_1012 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 13:81584392..81584845(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NUS1 | ||
| Ensembl ID: | ENSGGOG00000022321 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 85.43 % |
| Parental protein coverage: | 51.54 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | IFKRNNSRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDGKADIVRAAQDFCQ |
| .FKRN.S.LMDEILKQQ.ELLGLDCSKYSPEFANSNDK.DQVLNCHLAVKVLSP.DGKADI.RAAQDFCQ | |
| Retrocopy | LFKRNISILMDEILKQQ*ELLGLDCSKYSPEFANSNDKGDQVLNCHLAVKVLSPVDGKADILRAAQDFCQ |
| Parental | LVAQKQKRPTDLDVDTLGSLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFS |
| LVAQKQK..TDL.V..LGSLLSSNG.PDPDLVLK.GPVDS.LGFLP.HIR.TEIVSLP.HLNISY.DFFS | |
| Retrocopy | LVAQKQK*RTDLEVAMLGSLLSSNGSPDPDLVLKSGPVDSALGFLPQHIRFTEIVSLPAHLNISYDDFFS |
| Parental | ALRQYAACEQR |
| AL.Q.AAC.QR | |
| Retrocopy | ALHQGAACDQR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .89 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 2 .36 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .13 RPM |
| SRP007412_kidney | 0 .00 RPM | 6 .30 RPM |
| SRP007412_liver | 0 .00 RPM | 4 .09 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .29 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1289 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000001780 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000008948 | 1 retrocopy | |
| Homo sapiens | ENSG00000153989 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022321 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000007831 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013457 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000011553 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025886 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018547 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000003212 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007352 | 2 retrocopies |