RetrogeneDB ID: | retro_fcat_1750 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | F1:22826460..22826619(+) | ||
| Located in intron of: | ENSFCAG00000011286 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000023228 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 54.55 % |
| Parental protein coverage: | 68.75 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | KIFKGVLVVELVGVFGAYFLFNKMNTSQDFRQTMSKKFPFILEVYYKSIEQSGMY |
| KIFKG....ELV...G..FLFNK.NTSQDF...MSKKFPFI.......I.....Y | |
| Retrocopy | KIFKGISIAELV-FWGT*FLFNK-NTSQDFSSVMSKKFPFI*NIHLYRIRKGFCY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 17 .67 RPM |
| SRP017611_kidney | 0 .00 RPM | 16 .49 RPM |
| SRP017611_liver | 0 .00 RPM | 15 .16 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017579 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013008 | 2 retrocopies | |
| Felis catus | ENSFCAG00000023228 | 2 retrocopies |
retro_fcat_1289, retro_fcat_1750 ,
|
| Homo sapiens | ENSG00000218739 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025368 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000062691 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000029876 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000033858 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000040303 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000020689 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006884 | 7 retrocopies |