RetrogeneDB ID: | retro_fcat_146 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | A1:22432723..22432952(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFC1 | ||
| Ensembl ID: | ENSFCAG00000008548 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa [Source:HGNC Symbol;Acc:7705] |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MAPPALLRPFSKLLAPAR-IPSGSSARSKFYVREPAHDRPDWLKVGLTLGTSVFLWIYLIKQHNEDVLEY |
| .AP...L.PFSKLLA.A...PS.S...SKFY..EP.H.RPDWL.VGLTLGTS.FL.IYLIKQHNE.VLEY | |
| Retrocopy | LAPATYLCPFSKLLALAK>LPSSSAVQSKFYIWEPPHNRPDWLQVGLTLGTSIFL*IYLIKQHNEGVLEY |
| Parental | KRRNGLE |
| .RRNGLE | |
| Retrocopy | QRRNGLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 9 .99 RPM |
| SRP017611_kidney | 0 .00 RPM | 35 .35 RPM |
| SRP017611_liver | 0 .00 RPM | 9 .60 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011040 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000039582 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000015639 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000004800 | 11 retrocopies | |
| Felis catus | ENSFCAG00000008548 | 1 retrocopy |
retro_fcat_146 ,
|
| Loxodonta africana | ENSLAFG00000010459 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000006836 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009082 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000023590 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001107 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000007703 | 1 retrocopy |