RetrogeneDB ID: | retro_dnov_28 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_183797:3297..3528(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSDNOG00000025202 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000015639 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 76.32 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MAPSALLRPYSKLLALARFPSGXXXXXXXXXXXXXXSSPDWLKVGLTFGTTVFLWGYLINQHNEDVLEYK |
| MAPS.LLRPYSKLLALARFPSG..............SSPDWLKVGLTFGT..FLWGYLI.QHNEDVLEYK | |
| Retrocopy | MAPSTLLRPYSKLLALARFPSGSSAPSKFYVQEPPHSSPDWLKVGLTFGTSIFLWGYLISQHNEDVLEYK |
| Parental | RRNGLE |
| RRNGLE | |
| Retrocopy | RRNGLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 24 .50 RPM | 7 .97 RPM |
| SRP012922_cerebellum | 12 .92 RPM | 5 .50 RPM |
| SRP012922_heart | 36 .43 RPM | 11 .14 RPM |
| SRP012922_kidney | 23 .82 RPM | 11 .77 RPM |
| SRP012922_liver | 17 .03 RPM | 6 .97 RPM |
| SRP012922_lung | 11 .91 RPM | 3 .67 RPM |
| SRP012922_quadricep_muscle | 37 .91 RPM | 16 .27 RPM |
| SRP012922_spleen | 12 .82 RPM | 3 .55 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011040 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000039582 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000015639 | 1 retrocopy |
retro_dnov_28 ,
|
| Echinops telfairi | ENSETEG00000004800 | 11 retrocopies | |
| Felis catus | ENSFCAG00000008548 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000010459 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000006836 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009082 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000023590 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001107 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000007703 | 1 retrocopy |