RetrogeneDB ID: | retro_amel_805 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192651.1:750979..751207(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFC1 | ||
| Ensembl ID: | ENSAMEG00000011040 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.05 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MAPPALLRPFSKLLAPTRLSSGSSARSKFYVREPPHDRPDWLKVGLTLGTSVFLWIYLIKQHNEDVLEYK |
| MA.P.L..P..KLLA..RL..GS.A.SKFY...PP.DRPDWL.VGLTL.TS.FLW.YLIKQHNEDVLE.. | |
| Retrocopy | MATPTLSHPLCKLLALARLARGSLA*SKFYRWKPPRDRPDWLRVGLTLATSIFLWLYLIKQHNEDVLENQ |
| Parental | RRNGLE |
| RRNGLE | |
| Retrocopy | RRNGLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011040 | 2 retrocopies |
retro_amel_282, retro_amel_805 ,
|
| Bos taurus | ENSBTAG00000039582 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000015639 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000004800 | 11 retrocopies | |
| Felis catus | ENSFCAG00000008548 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000010459 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000006836 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009082 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000023590 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001107 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000007703 | 1 retrocopy |