RetrogeneDB ID: | retro_etel_229 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | GeneScaffold_3918:76885..77120(+) | ||
| Located in intron of: | ENSETEG00000009527 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CKS2 | ||
| Ensembl ID: | ENSETEG00000001260 | ||
| Aliases: | None | ||
| Description: | CDC28 protein kinase regulatory subunit 2 [Source:HGNC Symbol;Acc:2000] |
| Percent Identity: | 70.37 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 2 |
| Parental | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHL-MSEEEWRRLGVQQSLGW-VHYMIHEPEPHILL |
| .A.KQ.YYSD.YFDEHYE..HVMLPRELSKQV...HL.MSEEE.RR.GVQQ.L.W.VHYM.HEP..HILL | |
| Retrocopy | VAQKQRYYSDQYFDEHYEHQHVMLPRELSKQVLPNHL<MSEEE*RRVGVQQNLDW<VHYMVHEPKLHILL |
| Parental | FRRPLPKEQQK |
| F....PK.Q.K | |
| Retrocopy | FS*LIPKKQ*K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |