RetrogeneDB ID: | retro_eeur_183 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_180144:462..690(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CKS2 | ||
| Ensembl ID: | ENSEEUG00000004384 | ||
| Aliases: | None | ||
| Description: | CDC28 protein kinase regulatory subunit 2 [Source:HGNC Symbol;Acc:2000] |
| Percent Identity: | 82.05 % |
| Parental protein coverage: | 98.73 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | AHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRR |
| A.KQI.YS.KYFDEHYEYR.VMLPRELSKQVPKTHL.SEEE.RRLGVQ..LGW...MIHEP.PHILLFR. | |
| Retrocopy | AYKQICYSGKYFDEHYEYRSVMLPRELSKQVPKTHLISEEE*RRLGVQ--LGWAPSMIHEPGPHILLFR* |
| Parental | PLPKDQQK |
| P.PKDQQK | |
| Retrocopy | PIPKDQQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 4 .83 RPM |
| SRP017611_kidney | 0 .00 RPM | 3 .94 RPM |
| SRP017611_liver | 0 .00 RPM | 1 .93 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002194 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007792 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009427 | 8 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000004384 | 7 retrocopies |
retro_eeur_183 , retro_eeur_255, retro_eeur_293, retro_eeur_551, retro_eeur_632, retro_eeur_639, retro_eeur_640,
|
| Erinaceus europaeus | ENSEEUG00000015895 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000001260 | 10 retrocopies | |
| Felis catus | ENSFCAG00000022286 | 1 retrocopy | |
| Homo sapiens | ENSG00000123975 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000062248 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000007583 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021093 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014130 | 5 retrocopies | |
| Sorex araneus | ENSSARG00000002443 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000048 | 7 retrocopies |