RetrogeneDB ID: | retro_dnov_2530 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_83145:5574..5811(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CKS2 | ||
| Ensembl ID: | ENSDNOG00000009427 | ||
| Aliases: | None | ||
| Description: | CDC28 protein kinase regulatory subunit 2 [Source:HGNC Symbol;Acc:2000] |
| Percent Identity: | 91.14 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR |
| MAHKQIYYSDKYF.EHY.YRHVMLPRELSKQVPK..LMSEEEWRRLGVQQSLGWVHY.IHEPEPH.LLFR | |
| Retrocopy | MAHKQIYYSDKYFNEHYKYRHVMLPRELSKQVPKICLMSEEEWRRLGVQQSLGWVHYIIHEPEPHTLLFR |
| Parental | RPLPKDQQK |
| RP.PKDQQK | |
| Retrocopy | RPPPKDQQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .19 RPM | 12 .64 RPM |
| SRP012922_cerebellum | 0 .41 RPM | 0 .14 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .23 RPM |
| SRP012922_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP012922_liver | 0 .00 RPM | 0 .62 RPM |
| SRP012922_lung | 0 .00 RPM | 1 .22 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 0 .69 RPM |
| SRP012922_spleen | 0 .23 RPM | 30 .68 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002194 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007792 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009427 | 8 retrocopies |
retro_dnov_1200, retro_dnov_1527, retro_dnov_195, retro_dnov_1984, retro_dnov_2530 , retro_dnov_2532, retro_dnov_585, retro_dnov_755,
|
| Erinaceus europaeus | ENSEEUG00000004384 | 7 retrocopies | |
| Echinops telfairi | ENSETEG00000001260 | 10 retrocopies | |
| Felis catus | ENSFCAG00000022286 | 1 retrocopy | |
| Homo sapiens | ENSG00000123975 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000062248 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000007583 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021093 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014130 | 5 retrocopies | |
| Sorex araneus | ENSSARG00000002443 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000048 | 7 retrocopies |