RetrogeneDB ID: | retro_ecab_311 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 14:44635505..44635757(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FXN | ||
| Ensembl ID: | ENSECAG00000019174 | ||
| Aliases: | None | ||
| Description: | frataxin [Source:HGNC Symbol;Acc:3951] |
| Percent Identity: | 65.48 % |
| Parental protein coverage: | 54.19 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | FFEDLADKPYTFEDYDVSFGSGVLTIKMGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHD |
| F.E.LA.K.Y.F...DVSFGS..L.IK.GGD.G.Y..NKQTPNKQIWLSS.SSGP..YD..GKN.VYSHD | |
| Retrocopy | FVENLANKHYKFNH*DVSFGSSILVIKLGGDIGVYRTNKQTPNKQIWLSSSSSGPRHYDSNGKNSVYSHD |
| Parental | GVSLHELLAAELTK |
| ...LHE.L..ELT. | |
| Retrocopy | SIPLHEVLSTELTE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 3 .31 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 16 .15 RPM |
| SRP021940_embryo | 0 .00 RPM | 12 .91 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 4 .96 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 6 .53 RPM |
| SRP021940_testis | 0 .00 RPM | 5 .44 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_2203 |
| Macaca mulatta | retro_mmul_2038 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006915 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000005107 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001695 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000024066 | 3 retrocopies | |
| Equus caballus | ENSECAG00000019174 | 1 retrocopy |
retro_ecab_311 ,
|
| Homo sapiens | ENSG00000165060 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007636 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000000357 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000009619 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000059363 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000031105 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000015213 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010336 | 4 retrocopies |