RetrogeneDB ID: | retro_chof_94 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | GeneScaffold_1808:12941..13265(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FXN | ||
| Ensembl ID: | ENSCHOG00000005107 | ||
| Aliases: | None | ||
| Description: | frataxin [Source:HGNC Symbol;Acc:3951] |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 52.86 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | LAEETLDSLT-FFEDLADKSYTFEDYDVSFGSGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYD |
| ....TLDSL..FFE.L..KSYTFEDYDVSFGSGVLT.KLG..L.TYVINK.TP.KQI.LSSPSSGPK.YD | |
| Retrocopy | IQDKTLDSLVGFFEELVVKSYTFEDYDVSFGSGVLTVKLGRELETYVINKETPKKQISLSSPSSGPKCYD |
| Parental | WTGKNWVYSHDGVSLHELLTAELTAALKTKLDLSSLAYSGKD |
| .TGKNWV.SH....LHELL......ALKTKL.LSSL.YS.KD | |
| Retrocopy | *TGKNWVCSHGSRFLHELL----NSALKTKLNLSSLSYSKKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006915 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000005107 | 2 retrocopies |
retro_chof_349, retro_chof_94 ,
|
| Callithrix jacchus | ENSCJAG00000001695 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000024066 | 3 retrocopies | |
| Equus caballus | ENSECAG00000019174 | 1 retrocopy | |
| Homo sapiens | ENSG00000165060 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007636 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000000357 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000009619 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000059363 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000031105 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000015213 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010336 | 4 retrocopies |