RetrogeneDB ID: | retro_ecab_211 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 10:16468659..16468958(+) | ||
| Located in intron of: | ENSECAG00000026972 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | EBAG9 | ||
| Ensembl ID: | ENSECAG00000009719 | ||
| Aliases: | None | ||
| Description: | estrogen receptor binding site associated, antigen, 9 [Source:HGNC Symbol;Acc:3123] |
| Percent Identity: | 56.48 % |
| Parental protein coverage: | 50.23 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 1 |
| Parental | QKIIIKKREPLNFGIPDGSTG-FSSRLAATQDMPFIHQSPELGDLDTWQENTNAWEEEEDAAWQAEEVLR |
| QKI.I.K.EPLNF....GST..FSS.LAAT.D..F.H.SPELGD..T.QENTNA...EE..AW.A.EVL. | |
| Retrocopy | QKISIEKSEPLNFH*SIGSTD<FSSKLAAT*DILFMHPSPELGDRCTRQENTNA--REEGVAWRA-EVL* |
| Parental | QQKIADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKL |
| QQK.AD.E.RAA...RK...K....L..KE...I...L | |
| Retrocopy | QQKVADGEQRAAKNRRKWKRK----LRRKEKGTIETDL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 24 .03 RPM |
| SRP021940_cerebellum | 0 .26 RPM | 18 .54 RPM |
| SRP021940_embryo | 0 .13 RPM | 15 .83 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 16 .31 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 8 .48 RPM |
| SRP021940_testis | 0 .00 RPM | 25 .90 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006190 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007848 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000001059 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000010177 | 2 retrocopies | |
| Equus caballus | ENSECAG00000009719 | 2 retrocopies |
retro_ecab_211 , retro_ecab_232,
|
| Felis catus | ENSFCAG00000025490 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014115 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000004795 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000022339 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004220 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000006024 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000015326 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001745 | 2 retrocopies |