RetrogeneDB ID: | retro_ecab_190 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 1:133491584..133491777(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | COX6B1 | ||
| Ensembl ID: | ENSECAG00000012317 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) [Source:HGNC Symbol;Acc:2280] |
| Percent Identity: | 63.08 % |
| Parental protein coverage: | 74.42 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | NQNQTRNCWQNYLDFHRCEKAMTAKGGDVS-VCEWYRRVYKSLCPLSWVSAWDDRRAEGTFPGKI |
| NQNQ.R.CWQ.YL.FH.CE.A.T.K.GDV...C.WY..V..SL.P.S.V.AWD..RAEG.FPGKI | |
| Retrocopy | NQNQPRICWQFYLYFHHCEQALTTKRGDVA>TCKWYWHVHQSLYPAS*VTAWDAHRAEGAFPGKI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 41 .38 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 127 .34 RPM |
| SRP021940_embryo | 0 .00 RPM | 93 .90 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 73 .95 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 58 .50 RPM |
| SRP021940_testis | 0 .00 RPM | 58 .64 RPM |