RetrogeneDB ID: | retro_dnov_974 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_1288:160800..161002(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RBM3 | ||
| Ensembl ID: | ENSDNOG00000010420 | ||
| Aliases: | None | ||
| Description: | RNA binding motif (RNP1, RRM) protein 3 [Source:HGNC Symbol;Acc:9900] |
| Percent Identity: | 58.33 % |
| Parental protein coverage: | 58.82 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | GFITFTNPEHASDAMQAM-GESLDGRQIRVDHAGKSARGTRGGAFGGHGRGRSYSRGGGDQGYGSSR-YD |
| GF.....P.HASDAMQAM.GE.L.G....V....KS.RGTRGG....HG.G.SYS.GGG..G.GSSR.YD | |
| Retrocopy | GFGFTSKPRHASDAMQAMNGEFLVGCRVHVGPVSKSPRGTRGG----HGHGHSYSGGGGGPGFGSSR>YD |
| Parental | SR |
| S. | |
| Retrocopy | SQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 56 .40 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 29 .42 RPM |
| SRP012922_heart | 0 .00 RPM | 22 .28 RPM |
| SRP012922_kidney | 0 .00 RPM | 38 .06 RPM |
| SRP012922_liver | 0 .00 RPM | 23 .53 RPM |
| SRP012922_lung | 0 .00 RPM | 50 .86 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 14 .02 RPM |
| SRP012922_spleen | 0 .00 RPM | 71 .19 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000013718 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000025848 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015485 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000003553 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010420 | 16 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000017199 | 3 retrocopies | |
| Gadus morhua | ENSGMOG00000012137 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000007003 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020314 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000021591 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027493 | 1 retrocopy |