RetrogeneDB ID: | retro_dnov_2529 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_83012:3954..4341(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TSEN15 | ||
| Ensembl ID: | ENSDNOG00000017611 | ||
| Aliases: | None | ||
| Description: | tRNA splicing endonuclease 15 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:16791] |
| Percent Identity: | 81.06 % |
| Parental protein coverage: | 76.19 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | PKYLEMMELDIGDATQVYIAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPISAS |
| PKYLEMMELDIGD.TQVYIAFLV.LDLME.K......CVGLPELQLICL.GTE.E.....TVVP.PISAS | |
| Retrocopy | PKYLEMMELDIGDSTQVYIAFLVCLDLMENKI---IPCVGLPELQLICLGGTELER*EFLTVVPAPISAS |
| Parental | LSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQ----NISLRR |
| LSHNRIREILK.S.KLQG.PDLPMSFTLAIVESDSTIVYYKLT.GFMLPDPQ....NISLRR | |
| Retrocopy | LSHNRIREILKSSQKLQGNPDLPMSFTLAIVESDSTIVYYKLTNGFMLPDPQVSFENISLRR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 9 .14 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 7 .84 RPM |
| SRP012922_heart | 0 .00 RPM | 5 .80 RPM |
| SRP012922_kidney | 0 .00 RPM | 7 .12 RPM |
| SRP012922_liver | 0 .00 RPM | 4 .18 RPM |
| SRP012922_lung | 0 .15 RPM | 7 .79 RPM |
| SRP012922_quadricep_muscle | 0 .17 RPM | 3 .63 RPM |
| SRP012922_spleen | 0 .00 RPM | 10 .30 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016369 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005356 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017611 | 2 retrocopies |
retro_dnov_1176, retro_dnov_2529 ,
|
| Homo sapiens | ENSG00000198860 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015804 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000014109 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016409 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011790 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000014980 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000018024 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003128 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000421 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000023202 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000001103 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013230 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000002941 | 2 retrocopies |