RetrogeneDB ID: | retro_btau_971 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 22:20199548..20199999(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TSEN15 | ||
| Ensembl ID: | ENSBTAG00000016369 | ||
| Aliases: | TSEN15, C16H1ORF19 | ||
| Description: | tRNA-splicing endonuclease subunit Sen15 [Source:RefSeq peptide;Acc:NP_001069780] |
| Percent Identity: | 82.35 % |
| Parental protein coverage: | 89.29 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 3 |
| Parental | GDDRGGGSAHPWAP-EDAWMGTHPKYLEMMELDIGDATQVYIAFLVYLDLMESKSWHEVNCVGLPDLQLI |
| G.D.GGGSAHP.AP.ED.WMGTHPKYLEMMEL.I.DATQ.Y.AFL..LDL..SKSWHEVNCVGL.DLQLI | |
| Retrocopy | GGDCGGGSAHPRAP>EDTWMGTHPKYLEMMELIIRDATQAYTAFLACLDLIVSKSWHEVNCVGLLDLQLI |
| Parental | CLLGTEIEGE-GLQTVVPTPISASLSHNRIREILKASRKLQGDPD-LPTSFTLAIVESDSTIVYYKLTDG |
| .LL.TE.E.E.GLQ.VVPTPISASLSHNRIR.ILKAS.K.QGDPD.LP.SFTLAIVESDST.VYYKLTDG | |
| Retrocopy | HLLSTETEAE>GLQSVVPTPISASLSHNRIRGILKAS*K*QGDPD<LPMSFTLAIVESDSTTVYYKLTDG |
| Parental | FMLPDPQNISLRR |
| FMLPDP.NISLRR | |
| Retrocopy | FMLPDPKNISLRR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 33 .74 RPM |
| ERP005899_muscle | 0 .00 RPM | 7 .76 RPM |
| SRP017611_brain | 0 .00 RPM | 23 .11 RPM |
| SRP017611_kidney | 0 .00 RPM | 16 .54 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .83 RPM |
| SRP030211_testis | 0 .00 RPM | 14 .47 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016369 | 1 retrocopy |
retro_btau_971 ,
|
| Callithrix jacchus | ENSCJAG00000005356 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017611 | 2 retrocopies | |
| Homo sapiens | ENSG00000198860 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015804 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000014109 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016409 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011790 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000014980 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000018024 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003128 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000421 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000023202 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000001103 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013230 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000002941 | 2 retrocopies |