RetrogeneDB ID: | retro_dnov_1973 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_398:189539..189969(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | OSTC | ||
| Ensembl ID: | ENSDNOG00000011172 | ||
| Aliases: | None | ||
| Description: | oligosaccharyltransferase complex subunit (non-catalytic) [Source:HGNC Symbol;Acc:24448] |
| Percent Identity: | 81.94 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQR |
| .ETLYRVP.LVL..PNLKLKKPPWVH..SAM.VYALVVVSYFL..GGI.YDVIV.PPSVGSMT..HG.QR | |
| Retrocopy | VETLYRVPLLVLKGPNLKLKKPPWVHLLSAMIVYALVVVSYFLTNGGIMYDVIVGPPSVGSMTKAHGQQR |
| Parental | PVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNA-PNIPKLNRFLLLFIGFVCVLLSFFMARVFM |
| .VAFLAYRVNG.Y..EGLAS.FL.T.GGL.FIILDRSNA.PNIPKL.RFLLL.IGFVC.LLSFFMARVFM | |
| Retrocopy | QVAFLAYRVNGHYVIEGLASIFLLTIGGLRFIILDRSNA>PNIPKLSRFLLLVIGFVCILLSFFMARVFM |
| Parental | RMKL |
| RMKL | |
| Retrocopy | RMKL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 28 .39 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 6 .32 RPM |
| SRP012922_heart | 0 .00 RPM | 5 .10 RPM |
| SRP012922_kidney | 0 .00 RPM | 12 .05 RPM |
| SRP012922_liver | 0 .15 RPM | 23 .07 RPM |
| SRP012922_lung | 0 .00 RPM | 9 .16 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 3 .98 RPM |
| SRP012922_spleen | 0 .00 RPM | 14 .19 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011611 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016002 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000011172 | 2 retrocopies |
retro_dnov_12, retro_dnov_1973 ,
|
| Homo sapiens | ENSG00000198856 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000026873 | 6 retrocopies | |
| Loxodonta africana | ENSLAFG00000026381 | 7 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000478 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000020599 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000011056 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000024222 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000003446 | 1 retrocopy |