RetrogeneDB ID: | retro_dnov_1716 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_27393:7020..7336(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPD1 | ||
| Ensembl ID: | ENSDNOG00000018773 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein D1 polypeptide 16kDa [Source:HGNC Symbol;Acc:11158] |
| Percent Identity: | 70.75 % |
| Parental protein coverage: | 92.11 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | FLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLP |
| F..K.SHETVT.EL.NGTQV.GT.TG.DVSM.THLKA.KMTLK.RE.V.LETLSI.G...RY.IL.D.LP | |
| Retrocopy | FWVKVSHETVTLELNNGTQVCGTTTGMDVSMKTHLKATKMTLKSRETV*LETLSIGGSDHRYLILLDGLP |
| Parental | LDTLLVDVEPKVKSKKREA-XAGRGRGRGRGRGRGR |
| L..LLVDVEPKVK.KKRE...AGR.RG.GR.RG..R | |
| Retrocopy | LIILLVDVEPKVKFKKREV>LAGRRRGCGRERGGPR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 39 .48 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 21 .31 RPM |
| SRP012922_heart | 0 .00 RPM | 9 .28 RPM |
| SRP012922_kidney | 0 .00 RPM | 20 .26 RPM |
| SRP012922_liver | 0 .00 RPM | 8 .51 RPM |
| SRP012922_lung | 0 .00 RPM | 26 .57 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 8 .13 RPM |
| SRP012922_spleen | 0 .00 RPM | 32 .51 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000006364 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008292 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000018247 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018773 | 4 retrocopies | |
| Felis catus | ENSFCAG00000012352 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003992 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000005567 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000023761 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025874 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000009909 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000005511 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000013714 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000002654 | 2 retrocopies |