RetrogeneDB ID: | retro_dnov_1532 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_22798:50078..50512(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C12orf49 | ||
| Ensembl ID: | ENSDNOG00000001294 | ||
| Aliases: | None | ||
| Description: | chromosome 12 open reading frame 49 [Source:HGNC Symbol;Acc:26128] |
| Percent Identity: | 68.71 % |
| Parental protein coverage: | 86.9 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | KVQFNLGNSSRPGNQCRNSIQGKHLITDELGYV-CERKDLLVNGCCHVHVPSTKQYCCDGCLSNGCCSAY |
| KVQ.NLGN.S.PGN....SIQGK.L.TDELGY..CERK.L.V.GCCH.H.PSTK.YCCDGC.SN.C..A. | |
| Retrocopy | KVQLNLGNGSQPGNESHTSIQGKPLVTDELGYA<CERKELRVKGCCHEHGPSTK*YCCDGCSSNSCYGAC |
| Parental | EYCVSCCLQPNKQLLLERFLNRAAMAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGES |
| EYCVSCCLQP.K.LLLE.FL..AA.AFQNLF.A.EDH.EL.LA..RTSSQ....E.......AKYCYGES | |
| Retrocopy | EYCVSCCLQPSKHLLLEHFLVCAAVAFQNLFTAGEDHLELRLATGRTSSQHAVQEH-LQGSLAKYCYGES |
| Parental | PPELFPA |
| PP.LFPA | |
| Retrocopy | PPGLFPA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .39 RPM | 2 .14 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 3 .85 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .00 RPM |
| SRP012922_kidney | 0 .27 RPM | 4 .11 RPM |
| SRP012922_liver | 0 .46 RPM | 2 .01 RPM |
| SRP012922_lung | 0 .00 RPM | 2 .60 RPM |
| SRP012922_quadricep_muscle | 0 .17 RPM | 0 .87 RPM |
| SRP012922_spleen | 0 .00 RPM | 2 .63 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012481 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000047139 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009570 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000001294 | 9 retrocopies |
retro_dnov_126, retro_dnov_1532 , retro_dnov_1609, retro_dnov_1622, retro_dnov_1739, retro_dnov_2042, retro_dnov_2185, retro_dnov_2285, retro_dnov_232,
|
| Echinops telfairi | ENSETEG00000016892 | 3 retrocopies | |
| Homo sapiens | ENSG00000111412 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015690 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011912 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018247 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000005500 | 1 retrocopy |