RetrogeneDB ID: | retro_dnov_1279 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_175598:3555..3780(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NPM3 | ||
| Ensembl ID: | ENSDNOG00000018876 | ||
| Aliases: | None | ||
| Description: | nucleophosmin/nucleoplasmin 3 [Source:HGNC Symbol;Acc:7931] |
| Percent Identity: | 52. % |
| Parental protein coverage: | 55.97 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | LSGGTRSYTFEVEEEDDGEHVLALTMLCLTEGAKDECNVVEIVAQNNDHYEMAVPVANLKSCQPMLSPDD |
| LSG.T.S.TF..EEED..E..LAL.MLCLTE.A.DE..VV....QNN.H.E..V.VANL....P...... | |
| Retrocopy | LSGCTHSFTFKIEEEDNAERMLALPMLCLTEAAMDEHHVVDVGTQNNHHQEITVSVANLTVVLPTQAQPN |
| Parental | QLHSP |
| .L..P | |
| Retrocopy | PL*PP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 0 .97 RPM |
| SRP012922_cerebellum | 0 .14 RPM | 7 .29 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .23 RPM |
| SRP012922_kidney | 0 .00 RPM | 1 .10 RPM |
| SRP012922_liver | 0 .15 RPM | 0 .15 RPM |
| SRP012922_lung | 0 .15 RPM | 1 .53 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 0 .87 RPM |
| SRP012922_spleen | 0 .00 RPM | 0 .92 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017639 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000016335 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000009919 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000017650 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000006301 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018876 | 1 retrocopy |
retro_dnov_1279 ,
|
| Dipodomys ordii | ENSDORG00000003491 | 1 retrocopy | |
| Felis catus | ENSFCAG00000007178 | 1 retrocopy | |
| Homo sapiens | ENSG00000107833 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003465 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000011739 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004961 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015774 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000016894 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000056209 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000009229 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000002589 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000002875 | 1 retrocopy |