RetrogeneDB ID: | retro_cfam_2064 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | X:39412672..39413017(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NPM3 | ||
| Ensembl ID: | ENSCAFG00000009919 | ||
| Aliases: | None | ||
| Description: | nucleophosmin/nucleoplasmin 3 [Source:HGNC Symbol;Acc:7931] |
| Percent Identity: | 79.13 % |
| Parental protein coverage: | 56.93 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | VTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANL |
| VTMDSF.FGC.LS.HTRSFT.KVEEED..EH.LAL.MLCLT..A..ECNVVEV.AR.H.HQEIAVPVANL | |
| Retrocopy | VTMDSFSFGC*LSSHTRSFTLKVEEEDEVEHLLALAMLCLTKRAEEECNVVEVMARKHYHQEIAVPVANL |
| Parental | KLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTISNDV |
| KLSCQ.M.SLDD.QLQPPVTF.LKSGSGP..I.G.HQIV.ISNDV | |
| Retrocopy | KLSCQFMFSLDDLQLQPPVTFCLKSGSGPM*IAGQHQIVSISNDV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 15 .79 RPM |
| SRP017611_brain | 0 .00 RPM | 6 .27 RPM |
| SRP017611_kidney | 0 .00 RPM | 41 .87 RPM |
| SRP017611_liver | 0 .00 RPM | 14 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017639 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000016335 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000009919 | 2 retrocopies |
retro_cfam_1968, retro_cfam_2064 ,
|
| Canis familiaris | ENSCAFG00000016912 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000017650 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000006301 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018876 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000003491 | 1 retrocopy | |
| Felis catus | ENSFCAG00000007178 | 1 retrocopy | |
| Homo sapiens | ENSG00000107833 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003465 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000011739 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004961 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015774 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000056209 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000009229 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000002589 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000002875 | 1 retrocopy |